PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g06040.1
Common NameLR48_Vigan02g184300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 180aa    MW: 21141.6 Da    PI: 4.6971
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g06040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.7e-102361448
                     HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++v+ +G g W+  +++ g++R++k+c++rw++yl
   Vang06g06040.1  2 NYVQVHGEGKWRELSKRAGLKRCGKSCRLRWLNYL 36
                     68*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-14139IPR009057Homeodomain-like
PROSITE profilePS5129418.649140IPR017930Myb domain
CDDcd001675.04E-5236No hitNo description
PfamPF002491.2E-8236IPR001005SANT/Myb domain
SuperFamilySSF466892.38E-16266IPR009057Homeodomain-like
PROSITE profilePS500903.9963786IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.3E-74064IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MNYVQVHGEG KWRELSKRAG LKRCGKSCRL RWLNYLKPDI KRGNISSDEE DLIIRLHKLL  60
GNRCTKVMMP GNDSVNTMNF IATTWDHNPS ASMPQDDEHN HCFTGVLQDF DLGDFLMSYE  120
DDCRFNGYAC VEIPQHIFED QTWRLDDSMV EETWYENWKH DTYFSQEQDM DMDMGFSSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511901.11e-78PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0L9TYM43e-84A0A0L9TYM4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SNT33e-84A0A0S3SNT3_PHAAN; Uncharacterized protein
STRINGGLYMA10G35061.14e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3087922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.18e-32MYB family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]